SCOPe 2.05: Domain d4qrre1: 4qrr E:3-128

Lineage for d4qrre1 (4qrr E:3-128)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4qrre1: 4qrr E:3-128 [261564]
   Other proteins in same PDB: d4qrra1, d4qrrb_
   automated match to d2axhb1

Details for d4qrre1

PDB Entry: 4qrr, 3 Å

PDB Description: crystal structure of hla b*3501-ips in complex with a delta-beta tcr, clone 12 tcr

PDB Compounds: (E:) clone12 TCR alpha chain

SCOPe Domain Sequences for d4qrre1:

Sequence; same for both SEQRES and ATOM records:

>d4qrre1 b.1.1.0 (E:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
rfsgrqfsnsrsemnvstlelgdsalylcassleggyyneqffgpgtrltvte

Timeline for d4qrre1:

• d4qrre1 first appeared in SCOPe 2.04
  
• d4qrre1 appears in SCOPe 2.06
  
• d4qrre1 appears in the current release, SCOPe 2.08