Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [261442] (2 PDB entries) |
Domain d4ushb_: 4ush B: [261447] automated match to d2o66b_ complexed with so4 |
PDB Entry: 4ush (more details), 1.6 Å
SCOPe Domain Sequences for d4ushb_:
Sequence, based on SEQRES records: (download)
>d4ushb_ d.58.5.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} iqcdlsafpgvkffrieaifrpwrlpfvidtlskygirgltntpvkgvgvqggsreryag tefgpsnlvdkekldivvsraqvdavvrlvaasaytgeigdgkifvhpvaevvrirtae
>d4ushb_ d.58.5.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} iqcdlsafpgvkffrieaifrpwrlpfvidtlskygirgltntpvkgfgpsnlvdkekld ivvsraqvdavvrlvaasaytgeigdgkifvhpvaevvrirtae
Timeline for d4ushb_: