SCOPe 2.05: Domain d4ontc_: 4ont C:

Lineage for d4ontc_ (4ont C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (16 PDB entries)

8. Domain d4ontc_: 4ont C: [261370]
   automated match to d1ghqa_
   complexed with gol

Details for d4ontc_

PDB Entry: 4ont, 2.15 Å

PDB Description: ternary host recognition complex of complement factor h, c3d, and sialic acid

PDB Compounds: (C:) complement c3d fragment

SCOPe Domain Sequences for d4ontc_:

Sequence; same for both SEQRES and ATOM records:

>d4ontc_ a.102.4.4 (C:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d4ontc_:

• d4ontc_ first appeared in SCOPe 2.04
  
• d4ontc_ appears in SCOPe 2.06
  
• d4ontc_ appears in the current release, SCOPe 2.08