SCOPe 2.06: Domain d4lnub2: 4lnu B:246-441

Lineage for d4lnub2 (4lnu B:246-441)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)

8. Domain d4lnub2: 4lnu B:246-441 [261348]
   Other proteins in same PDB: d4lnua1, d4lnub1, d4lnud_
   automated match to d3rycd2
   complexed with gdp, gol, gtp, mes, mg, so4

Details for d4lnub2

PDB Entry: 4lnu, 2.19 Å

PDB Description: Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4lnub2:

Sequence; same for both SEQRES and ATOM records:

>d4lnub2 d.79.2.1 (B:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Timeline for d4lnub2:

• d4lnub2 first appeared in SCOPe 2.04
  
• d4lnub2 appears in SCOPe 2.05
  
• d4lnub2 appears in SCOPe 2.07
  
• d4lnub2 appears in the current release, SCOPe 2.08