SCOPe 2.07: Domain d4r9uc_: 4r9u C:

Lineage for d4r9uc_ (4r9u C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein automated matches [190723] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [261141] (1 PDB entry)

8. Domain d4r9uc_: 4r9u C: [261142]
   Other proteins in same PDB: d4r9ua_, d4r9ub_
   automated match to d2qi9c_
   complexed with anp, lda, mg

Details for d4r9uc_

PDB Entry: 4r9u, 2.79 Å

PDB Description: Structure of vitamin B12 transporter BtuCD in a nucleotide-bound outward facing state

PDB Compounds: (C:) Vitamin B12 import ATP-binding protein btuD

SCOPe Domain Sequences for d4r9uc_:

Sequence; same for both SEQRES and ATOM records:

>d4r9uc_ c.37.1.12 (C:) automated matches {Escherichia coli [TaxId: 83333]}
sivmqlqdvaestrlgplsgevrageilhlvgpngagkstllarmagmtsgkgsiqfagq
pleawsatklalhraylsqqqtppfatpvwhyltlhqhdktrtellndvagalalddklg
rstnqlsggewqrvrlaavvlqitpqanpagqlllldqpmcsldvaqqsaldkilsalsq
qglaivmsshdlnhtlrhahrawllkggkmlasgrreevltppnlaqaygmnfrrldieg
hrmlisti

Timeline for d4r9uc_:

• d4r9uc_ first appeared in SCOPe 2.04
  
• d4r9uc_ appears in SCOPe 2.06
  
• d4r9uc_ appears in the current release, SCOPe 2.08