SCOPe 2.06: Domain d4okaa1: 4oka A:14-134

Lineage for d4okaa1 (4oka A:14-134)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)

8. Domain d4okaa1: 4oka A:14-134 [260720]
   Other proteins in same PDB: d4okaa2
   automated match to d2bc3b_
   complexed with 5ir, ir

Details for d4okaa1

PDB Entry: 4oka, 2.5 Å

PDB Description: Structural-, Kinetic- and Docking Studies of Artificial Imine Reductases Based on the Biotin-Streptavidin Technology: An Induced Lock-and-Key Hypothesis

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d4okaa1:

Sequence; same for both SEQRES and ATOM records:

>d4okaa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltkgtteanawkstlvghdtftkv
k

Timeline for d4okaa1:

• d4okaa1 first appeared in SCOPe 2.04, called d4okaa_
  
• d4okaa1 was called d4okaa_ in SCOPe 2.05
  
• d4okaa1 appears in SCOPe 2.07
  
• d4okaa1 appears in the current release, SCOPe 2.08