Lineage for d4qakb_ (4qak B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199220Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2199221Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2199283Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2199284Protein automated matches [190796] (6 species)
    not a true protein
  7. 2199313Species Escherichia coli [TaxId:83333] [260567] (1 PDB entry)
  8. 2199315Domain d4qakb_: 4qak B: [260568]
    automated match to d1iuha_
    complexed with 2am, gol

Details for d4qakb_

PDB Entry: 4qak (more details), 2.02 Å

PDB Description: Crystal structure of phosphoesterase
PDB Compounds: (B:) 2'-5'-RNA ligase

SCOPe Domain Sequences for d4qakb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qakb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
epqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsl
lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpf
hphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d4qakb_:

Click to download the PDB-style file with coordinates for d4qakb_.
(The format of our PDB-style files is described here.)

Timeline for d4qakb_: