Lineage for d4npfx2 (4npf X:101-158)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986263Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1986264Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1986265Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1986302Protein automated matches [191290] (4 species)
    not a true protein
  7. 1986308Species Staphylococcus aureus [TaxId:1280] [189943] (15 PDB entries)
  8. 1986312Domain d4npfx2: 4npf X:101-158 [260511]
    automated match to d1h0ta_

Details for d4npfx2

PDB Entry: 4npf (more details), 1.49 Å

PDB Description: high-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
PDB Compounds: (X:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4npfx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4npfx2 a.8.1.1 (X:101-158) automated matches {Staphylococcus aureus [TaxId: 1280]}
adnkfnkeqqnawyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk

SCOPe Domain Coordinates for d4npfx2:

Click to download the PDB-style file with coordinates for d4npfx2.
(The format of our PDB-style files is described here.)

Timeline for d4npfx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4npfx1