Lineage for d4d1nc_ (4d1n C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236062Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2236063Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2236064Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2236862Protein automated matches [190421] (6 species)
    not a true protein
  7. 2237027Species Human (Homo sapiens) [TaxId:9606] [187302] (35 PDB entries)
  8. 2237038Domain d4d1nc_: 4d1n C: [260483]
    automated match to d3hsob_
    complexed with arg, gol, h4b, hem, zn

Details for d4d1nc_

PDB Entry: 4d1n (more details), 2.03 Å

PDB Description: Structure of human nNOS heme domain with L-Arg bound
PDB Compounds: (C:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d4d1nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d1nc_ d.174.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOPe Domain Coordinates for d4d1nc_:

Click to download the PDB-style file with coordinates for d4d1nc_.
(The format of our PDB-style files is described here.)

Timeline for d4d1nc_: