SCOPe 2.04: Domain d4v06b_: 4v06 B:

Lineage for d4v06b_ (4v06 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
   unusual fold

4. Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family)

5. Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)

6. Protein automated matches [191203] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189544] (3 PDB entries)

8. Domain d4v06b_: 4v06 B: [260461]
   automated match to d2toha_
   complexed with fe, imd

Details for d4v06b_

PDB Entry: 4v06, 2.63 Å

PDB Description: crystal structure of human tryptophan hydroxylase 2 (tph2), catalytic domain

PDB Compounds: (B:) tryptophan 5-hydroxylase 2

SCOPe Domain Sequences for d4v06b_:

Sequence; same for both SEQRES and ATOM records:

>d4v06b_ d.178.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvpwfprkiseldkcshrvlmygseldadhpgfkdnvyrqrrkyfvdvamgykygqpipr
veyteeetktwgvvfrelsklypthacreylknfplltkycgyrednvpqledvsmflke
rsgftvrpvagylsprdflaglayrvfhctqyirhgsdplytpepdtchellghvpllad
pkfaqfsqeiglaslgasdedvqklatcyfftiefglckqegqlraygagllssigelkh
alsdkacvkafdpkttclqeclittfqeayfvsesfeeakekmrdfaksitrpfsvyfnp
ytqsieilkdtrsienvvqdlrsdlntvcdalnkmnqylgi

Timeline for d4v06b_:

• d4v06b_ is new in SCOPe 2.04-stable
  
• d4v06b_ appears in SCOPe 2.05
  
• d4v06b_ appears in the current release, SCOPe 2.08