Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily) unusual fold |
Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) |
Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins) |
Protein automated matches [191203] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189544] (3 PDB entries) |
Domain d4v06a_: 4v06 A: [260460] automated match to d2toha_ complexed with fe, imd |
PDB Entry: 4v06 (more details), 2.63 Å
SCOPe Domain Sequences for d4v06a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v06a_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lyfqsmledvpwfprkiseldkcshrvlmygseldadhpgfkdnvyrqrrkyfvdvamgy kygqpiprveyteeetktwgvvfrelsklypthacreylknfplltkycgyrednvpqle dvsmflkersgftvrpvagylsprdflaglayrvfhctqyirhgsdplytpepdtchell ghvplladpkfaqfsqeiglaslgasdedvqklatcyfftiefglckqegqlraygagll ssigelkhalsdkacvkafdpkttclqeclittfqeayfvsesfeeakekmrdfaksitr pfsvyfnpytqsieilkdtrsienvvqdlrsdlntvcdalnkmnqylgi
Timeline for d4v06a_: