SCOPe 2.05: Domain d4uxua_: 4uxu A:

Lineage for d4uxua_ (4uxu A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [259757] (3 PDB entries)

8. Domain d4uxua_: 4uxu A: [260271]
   automated match to d3sq6a_
   complexed with edo, epe, mlk, na, nag

Details for d4uxua_

PDB Entry: 4uxu, 1.71 Å

PDB Description: crystal structure of the extracellular domain of the human alpha9 nicotinic acetylcholine receptor in complex with methyllycaconitine

PDB Compounds: (A:) neuronal acetylcholine receptor subunit alpha-9

SCOPe Domain Sequences for d4uxua_:

Sequence; same for both SEQRES and ATOM records:

>d4uxua_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiw
hdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwda
paitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhg
mpavknvisygccsepypdvtftlllkrrs

Timeline for d4uxua_:

• d4uxua_ first appeared in SCOPe 2.04
  
• d4uxua_ appears in SCOPe 2.06
  
• d4uxua_ appears in the current release, SCOPe 2.08