Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
Protein automated matches [190991] (1 species) not a true protein |
Species Pseudomonas mendocina [TaxId:300] [188696] (16 PDB entries) |
Domain d4p1cf_: 4p1c F: [260214] Other proteins in same PDB: d4p1ca_, d4p1cd_, d4p1ch_, d4p1ci_ automated match to d3ge3c_ complexed with fe, fes, peg |
PDB Entry: 4p1c (more details), 2.4 Å
SCOPe Domain Sequences for d4p1cf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p1cf_ d.15.12.0 (F:) automated matches {Pseudomonas mendocina [TaxId: 300]} safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf prdmtiaesglnptevidvvfe
Timeline for d4p1cf_: