Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) automatically mapped to Pfam PF00650 |
Family c.13.1.0: automated matches [227225] (1 protein) not a true family |
Protein automated matches [226966] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [258518] (2 PDB entries) |
Domain d4uyba2: 4uyb A:76-274 [260102] Other proteins in same PDB: d4uyba1, d4uyba3, d4uyba4 automated match to d1olma3 complexed with edo, unl |
PDB Entry: 4uyb (more details), 1.5 Å
SCOPe Domain Sequences for d4uyba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uyba2 c.13.1.0 (A:76-274) automated matches {Human (Homo sapiens) [TaxId: 9606]} ppeviqkympgglcgydrdgcpvwydiigpldpkgllfsvtkqdllktkmrdcerilhec dlqterlgkkietivmifdceglglkhfwkplvevyqeffglleenypetlkfmlivkat klfpvgynlmkpflsedtrrkiivlgnnwkegllklispeelpaqfggtltdpdgnpkcl tkinyggeipksmyvrdqv
Timeline for d4uyba2: