Lineage for d4uyba2 (4uyb A:76-274)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852201Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2852202Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2852238Family c.13.1.0: automated matches [227225] (1 protein)
    not a true family
  6. 2852239Protein automated matches [226966] (3 species)
    not a true protein
  7. 2852249Species Human (Homo sapiens) [TaxId:9606] [258518] (2 PDB entries)
  8. 2852250Domain d4uyba2: 4uyb A:76-274 [260102]
    Other proteins in same PDB: d4uyba1, d4uyba3, d4uyba4
    automated match to d1olma3
    complexed with edo, unl

Details for d4uyba2

PDB Entry: 4uyb (more details), 1.5 Å

PDB Description: crystal structure of sec14-like protein 3
PDB Compounds: (A:) sec14-like protein 3

SCOPe Domain Sequences for d4uyba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uyba2 c.13.1.0 (A:76-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppeviqkympgglcgydrdgcpvwydiigpldpkgllfsvtkqdllktkmrdcerilhec
dlqterlgkkietivmifdceglglkhfwkplvevyqeffglleenypetlkfmlivkat
klfpvgynlmkpflsedtrrkiivlgnnwkegllklispeelpaqfggtltdpdgnpkcl
tkinyggeipksmyvrdqv

SCOPe Domain Coordinates for d4uyba2:

Click to download the PDB-style file with coordinates for d4uyba2.
(The format of our PDB-style files is described here.)

Timeline for d4uyba2: