Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein Bungarotoxin [57324] (4 species) |
Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries) |
Domain d4uy2c_: 4uy2 C: [260099] Other proteins in same PDB: d4uy2a_, d4uy2b_ automated match to d1hc9a_ complexed with nag |
PDB Entry: 4uy2 (more details), 2.7 Å
SCOPe Domain Sequences for d4uy2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uy2c_ g.7.1.1 (C:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]} ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc stdkcnphpkqrp
Timeline for d4uy2c_: