Lineage for d4uy2c_ (4uy2 C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032155Protein Bungarotoxin [57324] (4 species)
  7. 3032156Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 3032162Domain d4uy2c_: 4uy2 C: [260099]
    Other proteins in same PDB: d4uy2a_, d4uy2b_
    automated match to d1hc9a_
    complexed with nag

Details for d4uy2c_

PDB Entry: 4uy2 (more details), 2.7 Å

PDB Description: crystal structure of the complex of the extracellular domain of human alpha9 nachr with alpha-bungarotoxin.
PDB Compounds: (C:) alpha-bungarotoxin isoform v31

SCOPe Domain Sequences for d4uy2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uy2c_ g.7.1.1 (C:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrp

SCOPe Domain Coordinates for d4uy2c_:

Click to download the PDB-style file with coordinates for d4uy2c_.
(The format of our PDB-style files is described here.)

Timeline for d4uy2c_: