SCOPe 2.07: Domain d3rvba2: 3rvb A:326-630

Lineage for d3rvba2 (3rvb A:326-630)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries)

8. Domain d3rvba2: 3rvb A:326-630 [260021]
   automated match to d1cu1a3
   complexed with cl, i79, mg

Details for d3rvba2

PDB Entry: 3rvb, 2.2 Å

PDB Description: The structure of HCV NS3 helicase (Heli-80) bound with inhibitor ITMN-3479

PDB Compounds: (A:) RNA helicase

SCOPe Domain Sequences for d3rvba2:

Sequence; same for both SEQRES and ATOM records:

>d3rvba2 c.37.1.14 (A:326-630) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsntgeipfygkaipievirggrhlifchskkkcdelaaklsalg
lnavayyrgldvsviptsgdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
idtttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwksltrlkptlhgptpllyrlgalqnevtlthpvtkfimacmsa
dlevv

Timeline for d3rvba2:

• d3rvba2 first appeared in SCOPe 2.04
  
• d3rvba2 appears in SCOPe 2.06
  
• d3rvba2 appears in the current release, SCOPe 2.08