Lineage for d4p2xa_ (4p2x A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197663Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197744Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2197745Protein automated matches [191274] (12 species)
    not a true protein
  7. 2197776Species Mycobacterium tuberculosis [225049] (4 PDB entries)
  8. 2197778Domain d4p2xa_: 4p2x A: [259681]
    automated match to d1yk9a_
    complexed with cl, mg, peg, so4

Details for d4p2xa_

PDB Entry: 4p2x (more details), 2.4 Å

PDB Description: swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 2
PDB Compounds: (A:) adenylate cyclase

SCOPe Domain Sequences for d4p2xa_:

Sequence, based on SEQRES records: (download)

>d4p2xa_ d.58.29.0 (A:) automated matches {Mycobacterium tuberculosis}
rniiadkydeasvlfadivgfterasstapadlvrfldrlysafdelvdqhglekikvsg
dsymvvsgvprprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgs
rrffydvwgdavnvasrmestdsvgqiqvpdevyerlkddfvlrerghinvkgkgvmrtw
yligrk

Sequence, based on observed residues (ATOM records): (download)

>d4p2xa_ d.58.29.0 (A:) automated matches {Mycobacterium tuberculosis}
rniiadkydeasvlfadivpalvrfldrlysafdelvdqhglekikgdsymvvsgvprpr
pdhtqaladfaldmtnvaaqlkdprnpvplrvglatgpvvagvvgsrrffydvwgdavnv
asrmestdsvgqiqvpdevyerlkddfvlrerghinvmrtwyligrk

SCOPe Domain Coordinates for d4p2xa_:

Click to download the PDB-style file with coordinates for d4p2xa_.
(The format of our PDB-style files is described here.)

Timeline for d4p2xa_: