Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [259622] (3 PDB entries) |
Domain d3wu2j_: 3wu2 J: [259623] Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_ automated match to d2axtj1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl |
PDB Entry: 3wu2 (more details), 1.9 Å
SCOPe Domain Sequences for d3wu2j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wu2j_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus vulcanus [TaxId: 32053]} ggriplwivatvagmgvivivglffygayaglgssl
Timeline for d3wu2j_: