Lineage for d3wu2j_ (3wu2 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026442Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species)
  7. 3026447Species Thermosynechococcus vulcanus [TaxId:32053] [259622] (3 PDB entries)
  8. 3026448Domain d3wu2j_: 3wu2 J: [259623]
    Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
    automated match to d2axtj1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2j_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d3wu2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2j_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus vulcanus [TaxId: 32053]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d3wu2j_:

Click to download the PDB-style file with coordinates for d3wu2j_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2j_: