Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d4tv9a2: 4tv9 A:246-439 [259545] Other proteins in same PDB: d4tv9a1, d4tv9b1, d4tv9c1, d4tv9d1, d4tv9e_, d4tv9f1, d4tv9f2 automated match to d4i50a2 complexed with 3h4, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4tv9 (more details), 2 Å
SCOPe Domain Sequences for d4tv9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tv9a2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d4tv9a2: