SCOP 1.59: Domain d3btte_: 3btt E:

Lineage for d3btte_ (3btt E:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Trypsin(ogen) [50515] (7 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (147 PDB entries)

8. Domain d3btte_: 3btt E: [25945]
   Other proteins in same PDB: d3btti_

Details for d3btte_

PDB Entry: 3btt, 1.9 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

SCOP Domain Sequences for d3btte_:

Sequence; same for both SEQRES and ATOM records:

>d3btte_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3btte_:

• d3btte_ first appeared (with stable ids) in SCOP 1.55
  
• d3btte_ appears in SCOP 1.57
  
• d3btte_ appears in SCOP 1.61
  
• d3btte_ appears in the current release, SCOPe 2.08