SCOPe 2.05: Domain d4mgir_: 4mgi R:

Lineage for d4mgir_ (4mgi R:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)

8. Domain d4mgir_: 4mgi R: [259365]
   automated match to d4hdob_
   complexed with cmp, so4

Details for d4mgir_

PDB Entry: 4mgi, 2.8 Å

PDB Description: selective activation of epac1 and epac2

PDB Compounds: (R:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d4mgir_:

Sequence, based on SEQRES records:

>d4mgir_ c.37.1.8 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtagte
qftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdled
ervvgkeqgqnlarqwnncaflessakskinvneifydlvrq

Sequence, based on observed residues (ATOM records):

>d4mgir_ c.37.1.8 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvqcmleildtagteqftam
rdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdledervvg
keqgqnlaflessakskinvneifydlvrq

Timeline for d4mgir_:

• d4mgir_ first appeared in SCOPe 2.04
  
• d4mgir_ appears in SCOPe 2.06
  
• d4mgir_ appears in the current release, SCOPe 2.08