Lineage for d1c2ga_ (1c2g A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128615Protein Trypsin(ogen) [50515] (9 species)
  7. 1128633Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
    Uniprot P00760
  8. 1128795Domain d1c2ga_: 1c2g A: [25917]
    complexed with bah, ca, dms, mg, zn

Details for d1c2ga_

PDB Entry: 1c2g (more details), 1.65 Å

PDB Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1c2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2ga_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1c2ga_:

Click to download the PDB-style file with coordinates for d1c2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1c2ga_: