Lineage for d4c1ib_ (4c1i B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508691Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1508692Protein automated matches [190983] (6 species)
    not a true protein
  7. 1508693Species Human (Homo sapiens) [TaxId:9606] [188676] (56 PDB entries)
  8. 1508787Domain d4c1ib_: 4c1i B: [259154]
    automated match to d3b2ra_
    complexed with eh9, mg, zn

Details for d4c1ib_

PDB Entry: 4c1i (more details), 2.4 Å

PDB Description: Selective Inhibitors of PDE2, PDE9, and PDE10: Modulators of Activity of the Central Nervous System
PDB Compounds: (B:) cgmp-dependent 3', 5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4c1ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c1ib_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
kaaelyervasnrehwtkvs

SCOPe Domain Coordinates for d4c1ib_:

Click to download the PDB-style file with coordinates for d4c1ib_.
(The format of our PDB-style files is described here.)

Timeline for d4c1ib_: