Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) active dimer is formed by strand 5 swapping |
Family c.54.1.0: automated matches [191356] (1 protein) not a true family |
Protein automated matches [190395] (6 species) not a true protein |
Species Streptococcus agalactiae [TaxId:211110] [259107] (1 PDB entry) |
Domain d4tkza_: 4tkz A: [259108] automated match to d3iprc_ complexed with gol |
PDB Entry: 4tkz (more details), 1.8 Å
SCOPe Domain Sequences for d4tkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tkza_ c.54.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 211110]} mikiiivahgnfpdgilssleliaghqeyvvginfiagmssndvrvalqrevidfkeilv ltdllggtpfnvssalsveytdkkikvlsglnlsmlmeavlsrtmfehvddlvdkvitss hegivdfstc
Timeline for d4tkza_: