SCOPe 2.04: Domain d4tkzb_: 4tkz B:

Lineage for d4tkzb_ (4tkz B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (6 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:211110] [259107] (1 PDB entry)

8. Domain d4tkzb_: 4tkz B: [259109]
   automated match to d3iprc_
   complexed with gol

Details for d4tkzb_

PDB Entry: 4tkz, 1.8 Å

PDB Description: crystal structure of phosphotransferase system component eiia from streptococcus agalactiae

PDB Compounds: (B:) Putative uncharacterized protein gbs1890

SCOPe Domain Sequences for d4tkzb_:

Sequence; same for both SEQRES and ATOM records:

>d4tkzb_ c.54.1.0 (B:) automated matches {Streptococcus agalactiae [TaxId: 211110]}
mikiiivahgnfpdgilssleliaghqeyvvginfiagmssndvrvalqrevidfkeilv
ltdllggtpfnvssalsveytdkkikvlsglnlsmlmeavlsrtmfehvddlvdkvitss
hegivdfstc

Timeline for d4tkzb_:

• d4tkzb_ is new in SCOPe 2.04-stable
  
• d4tkzb_ appears in SCOPe 2.05
  
• d4tkzb_ appears in the current release, SCOPe 2.08