Lineage for d3wtsg_ (3wts G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798806Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 1798807Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 1798808Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)
  6. 1798822Protein automated matches [259048] (1 species)
    not a true protein
  7. 1798823Species Mouse (Mus musculus) [TaxId:10090] [259049] (7 PDB entries)
  8. 1798827Domain d3wtsg_: 3wts G: [259050]
    Other proteins in same PDB: d3wtsa_, d3wtsc_, d3wtsf_
    automated match to d2jhba_
    protein/DNA complex

Details for d3wtsg_

PDB Entry: 3wts (more details), 2.35 Å

PDB Description: crystal structure of the complex comprised of ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (G:) Core-binding factor subunit beta

SCOPe Domain Sequences for d3wtsg_:

Sequence, based on SEQRES records: (download)

>d3wtsg_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedala

Sequence, based on observed residues (ATOM records): (download)

>d3wtsg_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee
raqqedala

SCOPe Domain Coordinates for d3wtsg_:

Click to download the PDB-style file with coordinates for d3wtsg_.
(The format of our PDB-style files is described here.)

Timeline for d3wtsg_: