SCOPe 2.05: Domain d4u1gf1: 4u1g F:1-111

Lineage for d4u1gf1 (4u1g F:1-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (15 PDB entries)

8. Domain d4u1gf1: 4u1g F:1-111 [259031]
   Other proteins in same PDB: d4u1gc2, d4u1gf2
   automated match to d1a5fl1

Details for d4u1gf1

PDB Entry: 4u1g, 3.1 Å

PDB Description: plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody qa1

PDB Compounds: (F:) QA1 monoclonal antibody light chain

SCOPe Domain Sequences for d4u1gf1:

Sequence; same for both SEQRES and ATOM records:

>d4u1gf1 b.1.1.0 (F:1-111) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
divltqspaslavslgqratiscrasqsvstssytyfhwyqqkpgqppklliryasnles
gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleik

Timeline for d4u1gf1:

• d4u1gf1 first appeared in SCOPe 2.04
  
• d4u1gf1 appears in SCOPe 2.06
  
• d4u1gf1 appears in the current release, SCOPe 2.08