Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [225579] (5 PDB entries) |
Domain d4topb1: 4top B:1-83 [258818] Other proteins in same PDB: d4topa2, d4topb2 automated match to d3fhsa1 complexed with gsh |
PDB Entry: 4top (more details), 2.35 Å
SCOPe Domain Sequences for d4topb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4topb1 c.47.1.0 (B:1-83) automated matches {Soybean (Glycine max) [TaxId: 3847]} msdevvlldfwpspfgmrvrialaekgikyeykeedlrnksplllqmnpvhkkipvlihn gkpicesliavqyieevwndrnp
Timeline for d4topb1: