SCOPe 2.04: Domain d4topb1: 4top B:1-83

Lineage for d4topb1 (4top B:1-83)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225579] (4 PDB entries)

8. Domain d4topb1: 4top B:1-83 [258818]
   Other proteins in same PDB: d4topb2
   automated match to d3fhsa1
   complexed with gsh

Details for d4topb1

PDB Entry: 4top, 2.35 Å

PDB Description: glycine max glutathione transferase

PDB Compounds: (B:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d4topb1:

Sequence; same for both SEQRES and ATOM records:

>d4topb1 c.47.1.0 (B:1-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
msdevvlldfwpspfgmrvrialaekgikyeykeedlrnksplllqmnpvhkkipvlihn
gkpicesliavqyieevwndrnp

Timeline for d4topb1:

• d4topb1 is new in SCOPe 2.04-stable
  
• d4topb1 appears in SCOPe 2.05
  
• d4topb1 appears in the current release, SCOPe 2.08