Lineage for d4qa3a1 (4qa3 A:14-377)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874190Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2874235Protein automated matches [190786] (1 species)
    not a true protein
  7. 2874236Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries)
  8. 2874302Domain d4qa3a1: 4qa3 A:14-377 [258794]
    Other proteins in same PDB: d4qa3a2
    automated match to d2v5wb_
    complexed with gol, k, tsn, zn

Details for d4qa3a1

PDB Entry: 4qa3 (more details), 2.88 Å

PDB Description: Crystal structure of T311M HDAC8 in complex with Trichostatin A (TSA)
PDB Compounds: (A:) Histone deacetylase 8

SCOPe Domain Sequences for d4qa3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qa3a1 c.42.1.2 (A:14-377) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlanmar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d4qa3a1:

Click to download the PDB-style file with coordinates for d4qa3a1.
(The format of our PDB-style files is described here.)

Timeline for d4qa3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qa3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4qa3b_