Lineage for d4lypa1 (4lyp A:-1-413)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441732Species Rhizomucor miehei [TaxId:4839] [256971] (7 PDB entries)
  8. 2441733Domain d4lypa1: 4lyp A:-1-413 [258672]
    Other proteins in same PDB: d4lypa2, d4lypb2
    automated match to d1uuqa_
    complexed with gai, trs

Details for d4lypa1

PDB Entry: 4lyp (more details), 1.28 Å

PDB Description: Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei
PDB Compounds: (A:) Exo-beta-1,4-mannosidase

SCOPe Domain Sequences for d4lypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lypa1 c.1.8.0 (A:-1-413) automated matches {Rhizomucor miehei [TaxId: 4839]}
efafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemgin
nlrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnfwq
wsggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytvqn
rrntvngkiykedpvimswqianepqeapaswfeeistfikkgapkhlvsagleskldey
dfdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkpiv
meefgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfwaygg
egrstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkelsk

SCOPe Domain Coordinates for d4lypa1:

Click to download the PDB-style file with coordinates for d4lypa1.
(The format of our PDB-style files is described here.)

Timeline for d4lypa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lypa2