SCOPe 2.02: Domain d1tgna_: 1tgn A:

Lineage for d1tgna_ (1tgn A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d1tgna_: 1tgn A: [25866]

Details for d1tgna_

PDB Entry: 1tgn, 1.65 Å

PDB Description: structure of bovine trypsinogen at 1.9 angstroms resolution

PDB Compounds: (A:) trypsinogen

SCOPe Domain Sequences for d1tgna_:

Sequence; same for both SEQRES and ATOM records:

>d1tgna_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
vggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegn
eqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgw
gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tgna_:

• d1tgna_ first appeared (with stable ids) in SCOP 1.55, called d1tgn__
  
• d1tgna_ appears in SCOPe 2.01
  
• d1tgna_ appears in SCOPe 2.03
  
• d1tgna_ appears in the current release, SCOPe 2.08