Lineage for d3wexa2 (3wex A:83-181)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765974Domain d3wexa2: 3wex A:83-181 [258589]
    Other proteins in same PDB: d3wexa1, d3wexc1, d3wexe1, d3wexg1
    automated match to d1f3ja1
    complexed with nag

Details for d3wexa2

PDB Entry: 3wex (more details), 2.4 Å

PDB Description: crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
PDB Compounds: (A:) MHC class II antigen

SCOPe Domain Sequences for d3wexa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wexa2 b.1.1.0 (A:83-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
andppevtvfpkepvelgqpntlichidrffppvlnvtwlcngepvtegvaeslflprtd
ysfhkfhyltfvpsaedvydcrvehwgldqpllkhweaq

SCOPe Domain Coordinates for d3wexa2:

Click to download the PDB-style file with coordinates for d3wexa2.
(The format of our PDB-style files is described here.)

Timeline for d3wexa2: