Lineage for d4qq7b1 (4qq7 B:1-78)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487227Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries)
  8. 2487231Domain d4qq7b1: 4qq7 B:1-78 [258484]
    Other proteins in same PDB: d4qq7a2, d4qq7a3, d4qq7b2, d4qq7b3
    automated match to d3mdkb1
    complexed with glo, gsh

Details for d4qq7b1

PDB Entry: 4qq7 (more details), 2.2 Å

PDB Description: crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
PDB Compounds: (B:) Putative stringent starvation protein A

SCOPe Domain Sequences for d4qq7b1:

Sequence, based on SEQRES records: (download)

>d4qq7b1 c.47.1.0 (B:1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlfnkpedisvmnpygqvpilverdlil
yesniineyiderfphpq

Sequence, based on observed residues (ATOM records): (download)

>d4qq7b1 c.47.1.0 (B:1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlkpedisvmnpygqvpilverdlilye
sniineyiderfphpq

SCOPe Domain Coordinates for d4qq7b1:

Click to download the PDB-style file with coordinates for d4qq7b1.
(The format of our PDB-style files is described here.)

Timeline for d4qq7b1: