Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries) |
Domain d4qq7b1: 4qq7 B:1-78 [258484] Other proteins in same PDB: d4qq7a2, d4qq7a3, d4qq7b2, d4qq7b3 automated match to d3mdkb1 complexed with glo, gsh |
PDB Entry: 4qq7 (more details), 2.2 Å
SCOPe Domain Sequences for d4qq7b1:
Sequence, based on SEQRES records: (download)
>d4qq7b1 c.47.1.0 (B:1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlfnkpedisvmnpygqvpilverdlil yesniineyiderfphpq
>d4qq7b1 c.47.1.0 (B:1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlkpedisvmnpygqvpilverdlilye sniineyiderfphpq
Timeline for d4qq7b1: