SCOPe 2.04: Domain d4qq7b1: 4qq7 B:-1-78

Lineage for d4qq7b1 (4qq7 B:-1-78)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries)

8. Domain d4qq7b1: 4qq7 B:-1-78 [258484]
   Other proteins in same PDB: d4qq7b2
   automated match to d3mdkb1
   complexed with glo, gsh

Details for d4qq7b1

PDB Entry: 4qq7, 2.2 Å

PDB Description: crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione

PDB Compounds: (B:) Putative stringent starvation protein A

SCOPe Domain Sequences for d4qq7b1:

Sequence, based on SEQRES records:

>d4qq7b1 c.47.1.0 (B:-1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
gsmmvlysgttcpfsqrcrlvlfekgmdfeirdvdlfnkpedisvmnpygqvpilverdl
ilyesniineyiderfphpq

Sequence, based on observed residues (ATOM records):

>d4qq7b1 c.47.1.0 (B:-1-78) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
gsmmvlysgttcpfsqrcrlvlfekgmdfeirdvdlkpedisvmnpygqvpilverdlil
yesniineyiderfphpq

Timeline for d4qq7b1:

• d4qq7b1 is new in SCOPe 2.04-stable
  
• d4qq7b1 appears in SCOPe 2.05
  
• d4qq7b1 appears in the current release, SCOPe 2.08