Lineage for d4q7ta_ (4q7t A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1899479Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1899480Protein automated matches [190526] (20 species)
    not a true protein
  7. 1899544Species Coral (Discosoma sp.) [TaxId:86600] [258320] (3 PDB entries)
  8. 1899548Domain d4q7ta_: 4q7t A: [258323]
    automated match to d3ztfa_

Details for d4q7ta_

PDB Entry: 4q7t (more details), 1.94 Å

PDB Description: Crystal structure of photoswitchable fluorescent protein PSmOrange
PDB Compounds: (A:) PSmOrange

SCOPe Domain Sequences for d4q7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7ta_ d.22.1.0 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvrmegtvnghefeiegegegrpyegfqtaklkvtkggplpfawdilsplx
skayvkhpadipdyfklsfpegfkwervmnyedggvvtvtqdsslqdgefiykvkmrgtn
fpsdgpvmqkktmgweassermypedgalkgeirmrlklkdgghytsevkttykakksvq
lpgayivgiklditshnedytiveqyeraegrhst

SCOPe Domain Coordinates for d4q7ta_:

Click to download the PDB-style file with coordinates for d4q7ta_.
(The format of our PDB-style files is described here.)

Timeline for d4q7ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q7tb_