Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Brachybacterium faecium [TaxId:446465] [258122] (1 PDB entry) |
Domain d4pfqe1: 4pfq E:25-207 [258126] Other proteins in same PDB: d4pfqc2, d4pfqe2, d4pfqf2, d4pfqh2 automated match to d3h83a_ complexed with mg |
PDB Entry: 4pfq (more details), 2.1 Å
SCOPe Domain Sequences for d4pfqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pfqe1 c.61.1.0 (E:25-207) automated matches {Brachybacterium faecium [TaxId: 446465]} pqthphpdvdrvlldeqqirdrlaelgeqiaadyaeeppvlvgvlrgavmvmadlarqid lkvemdwmavssygsgtkssgvvrilkdlsgditdrnvlivediidsgltlkwllsnlrs rgpksvevaallrkpdaarvdidvkyigfdipsefvigygldyaenyrnlpyvgvlsrsv yed
Timeline for d4pfqe1: