SCOPe 2.08: Domain d4n9hb2: 4n9h B:138-209

Lineage for d4n9hb2 (4n9h B:138-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)

8. Domain d4n9hb2: 4n9h B:138-209 [257973]
   Other proteins in same PDB: d4n9ha1, d4n9hb1
   automated match to d1g6nb1

Details for d4n9hb2

PDB Entry: 4n9h, 2.2 Å

PDB Description: Crystal structure of Transcription regulation Protein CRP

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d4n9hb2:

Sequence; same for both SEQRES and ATOM records:

>d4n9hb2 a.4.5.4 (B:138-209) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

Timeline for d4n9hb2:

• d4n9hb2 first appeared in SCOPe 2.04
  
• d4n9hb2 appears in SCOPe 2.07