Lineage for d4bvva_ (4bvv A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638139Protein automated matches [226950] (2 species)
    not a true protein
  7. 2638140Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)
  8. 2638148Domain d4bvva_: 4bvv A: [257720]
    automated match to d2knfa_
    complexed with cpf, so4

Details for d4bvva_

PDB Entry: 4bvv (more details), 1.8 Å

PDB Description: Identification of small molecule inhibitors selective for apo(a) kringles KIV-7, KIV-10 and KV.
PDB Compounds: (A:) apolipoprotein(a)

SCOPe Domain Sequences for d4bvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bvva_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcmfgngkgyrgkkattvtgtpcqewaaqephrhstfipgtnkwagleknycrnpdgdin
gpwcytmnprklfdycdiplc

SCOPe Domain Coordinates for d4bvva_:

Click to download the PDB-style file with coordinates for d4bvva_.
(The format of our PDB-style files is described here.)

Timeline for d4bvva_: