PDB entry 4bvv

View 4bvv on RCSB PDB site
Description: Identification of small molecule inhibitors selective for apo(a) kringles KIV-7, KIV-10 and KV.
Class: hydrolase
Keywords: hydrolase, cardiovascular disease, drug discovery, optical biosensors
Deposited on 2013-06-28, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19953
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein(a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bvva_
  • Heterogens: CPF, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4bvvA (A:)
dcmfgngkgyrgkkattvtgtpcqewaaqephrhstfipgtnkwagleknycrnpdgdin
gpwcytmnprklfdycdiplc