Lineage for d4bvda_ (4bvd A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638139Protein automated matches [226950] (2 species)
    not a true protein
  7. 2638140Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)
  8. 2638143Domain d4bvda_: 4bvd A: [257716]
    automated match to d3kiva_
    complexed with bu6, cl

Details for d4bvda_

PDB Entry: 4bvd (more details), 1.68 Å

PDB Description: identification of small molecule inhibitors selective for apo(a) kringles kiv-7, kiv-10 and kv.
PDB Compounds: (A:) apolipoprotein(a)

SCOPe Domain Sequences for d4bvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bvda_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgpw
cftmdpsirweycaltrc

SCOPe Domain Coordinates for d4bvda_:

Click to download the PDB-style file with coordinates for d4bvda_.
(The format of our PDB-style files is described here.)

Timeline for d4bvda_: