PDB entry 4bvd

View 4bvd on RCSB PDB site
Description: Identification of small molecule inhibitors selective for apo(a) kringles KIV-7, KIV-10 and KV.
Class: hydrolase
Keywords: hydrolase, cardiovascular disease, optical biosensors
Deposited on 2013-06-25, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.1775
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein(a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08519 (Start-78)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d4bvda_
  • Heterogens: CL, BU6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4bvdA (A:)
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcftmdpsirweycaltrc

    Sequence, based on observed residues (ATOM records): (download) 
    >4bvdA (A:)
cyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgpw
cftmdpsirweycaltrc