Lineage for d4qkua1 (4qku A:7-133)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784716Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) (S)
    automatically mapped to Pfam PF09298
  5. 1784730Family b.34.8.0: automated matches [257687] (1 protein)
    not a true family
  6. 1784731Protein automated matches [257688] (1 species)
    not a true protein
  7. 1784732Species Burkholderia cenocepacia [TaxId:216591] [257689] (1 PDB entry)
  8. 1784733Domain d4qkua1: 4qku A:7-133 [257690]
    Other proteins in same PDB: d4qkua2, d4qkub2, d4qkuc2, d4qkud2
    automated match to d1hyoa1
    complexed with edo, na, so4

Details for d4qkua1

PDB Entry: 4qku (more details), 2.45 Å

PDB Description: Crystal structure of a putative hydrolase from Burkholderia cenocepacia
PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d4qkua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qkua1 b.34.8.0 (A:7-133) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
wratldparkswietandpacdfpiqnlpfgifsdakgarrpgvalgdqivdlaalarag
lvtlpagadvlaaptlnafialgrdawrsvrvqlsalfsrddatlrddaalraqvlvaqr
datlhlp

SCOPe Domain Coordinates for d4qkua1:

Click to download the PDB-style file with coordinates for d4qkua1.
(The format of our PDB-style files is described here.)

Timeline for d4qkua1: