SCOPe 2.05: Domain d4p9hl2: 4p9h L:107-211

Lineage for d4p9hl2 (4p9h L:107-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4p9hl2: 4p9h L:107-211 [257454]
   Other proteins in same PDB: d4p9hc1, d4p9hc2, d4p9hl1
   automated match to d1dn0a2
   complexed with bam, epe, nag

Details for d4p9hl2

PDB Entry: 4p9h, 3 Å

PDB Description: crystal structure of 8anc195 fab in complex with gp120 of 93th057 hiv- 1 and soluble cd4 d1d2

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4p9hl2:

Sequence; same for both SEQRES and ATOM records:

>d4p9hl2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4p9hl2:

• d4p9hl2 first appeared in SCOPe 2.04
  
• d4p9hl2 appears in SCOPe 2.06
  
• d4p9hl2 appears in the current release, SCOPe 2.08