SCOPe 2.06: Domain d4o58b_: 4o58 B:

Lineage for d4o58b_ (4o58 B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d4o58b_: 4o58 B: [257224]
   Other proteins in same PDB: d4o58a1, d4o58a2, d4o58l1, d4o58l2
   automated match to d2viub_
   complexed with nag, peg, so4

Details for d4o58b_

PDB Entry: 4o58, 2.75 Å

PDB Description: crystal structure of broadly neutralizing antibody f045-092 in complex with a/victoria/3/1975 (h3n2) influenza hemagglutinin

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4o58b_:

Sequence; same for both SEQRES and ATOM records:

>d4o58b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq

Timeline for d4o58b_:

• d4o58b_ first appeared in SCOPe 2.04
  
• d4o58b_ appears in SCOPe 2.05
  
• d4o58b_ appears in SCOPe 2.07
  
• d4o58b_ appears in the current release, SCOPe 2.08