Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (12 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries) |
Domain d4o58b_: 4o58 B: [257224] Other proteins in same PDB: d4o58a1, d4o58a2, d4o58l1, d4o58l2 automated match to d2viub_ complexed with nag, peg, so4 |
PDB Entry: 4o58 (more details), 2.75 Å
SCOPe Domain Sequences for d4o58b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o58b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq
Timeline for d4o58b_:
View in 3D Domains from other chains: (mouse over for more information) d4o58a1, d4o58a2, d4o58l1, d4o58l2 |