SCOPe 2.08: Domain d4nila1: 4nil A:2-274

Lineage for d4nila1 (4nil A:2-274)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein Dihydropteroate synthetase [51719] (5 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
   Uniprot Q81VW8

8. Domain d4nila1: 4nil A:2-274 [257165]
   Other proteins in same PDB: d4nila2
   automated match to d1tx2a_
   complexed with 2o8, so4

Details for d4nila1

PDB Entry: 4nil, 2.18 Å

PDB Description: crystal structure of b. anthracis dhps with compound 5: 4- [(trifluoromethyl)sulfanyl]benzamide

PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d4nila1:

Sequence; same for both SEQRES and ATOM records:

>d4nila1 c.1.21.1 (A:2-274) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Timeline for d4nila1:

• d4nila1 first appeared in SCOPe 2.04, called d4nila_
  
• d4nila1 appears in SCOPe 2.07