SCOPe 2.06: Domain d4niga_: 4nig A:

Lineage for d4niga_ (4nig A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein automated matches [191077] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189001] (22 PDB entries)

8. Domain d4niga_: 4nig A: [257162]
   automated match to d3khca_
   protein/DNA complex; protein/RNA complex; complexed with akg, mn; mutant

Details for d4niga_

PDB Entry: 4nig, 1.52 Å

PDB Description: Crystal structure of AlkB D135I/E136H mutant protein with cofactors bound to dsDNA containing m6A/A

PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d4niga_:

Sequence; same for both SEQRES and ATOM records:

>d4niga_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
dkihpdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqagk

Timeline for d4niga_:

• d4niga_ first appeared in SCOPe 2.04
  
• d4niga_ appears in SCOPe 2.05
  
• d4niga_ appears in SCOPe 2.07
  
• d4niga_ appears in the current release, SCOPe 2.08