Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.31: ThiG-like [110399] (2 families) shares the common phosphate-binding site with other superfamilies |
Family c.1.31.0: automated matches [191453] (1 protein) not a true family |
Protein automated matches [190693] (3 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:797057] [257127] (2 PDB entries) |
Domain d4n6fa_: 4n6f A: [257129] automated match to d1tyga_ complexed with ca, f6r |
PDB Entry: 4n6f (more details), 2.25 Å
SCOPe Domain Sequences for d4n6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6fa_ c.1.31.0 (A:) automated matches {Amycolatopsis orientalis [TaxId: 797057]} depwlkigarefrsrilvgieqydsvplvrdvlnaagadvfittvdpdnrrsslllmdla delplddftwigttsfartkesalrsarilrdslgieilkldvrgddntpdnagtveaar elraegmellpfilpdlataraleeagcaalrvmaspvasgrgianpaairelieqigip vvveggigsarhvaeamelgasatlvntalvraespllmaaamrqaalagllsyesgpmp ev
Timeline for d4n6fa_: