SCOPe 2.05: Domain d4m3ea1: 4m3e A:22-94

Lineage for d4m3ea1 (4m3e A:22-94)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (10 PDB entries)
   Uniprot P96222 22-215

8. Domain d4m3ea1: 4m3e A:22-94 [257067]
   Other proteins in same PDB: d4m3ea2
   automated match to d1t56a1
   protein/DNA complex; complexed with 2b3

Details for d4m3ea1

PDB Entry: 4m3e, 2.11 Å

PDB Description: Rapid and efficient design of new inhibitors of Mycobacterium tuberculosis transcriptional repressor EthR using fragment growing, merging and linking approaches

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4m3ea1:

Sequence; same for both SEQRES and ATOM records:

>d4m3ea1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d4m3ea1:

• d4m3ea1 first appeared in SCOPe 2.04
  
• d4m3ea1 appears in SCOPe 2.06
  
• d4m3ea1 appears in the current release, SCOPe 2.08